Search.com.tr Logo
A B C D E F G H İ J K L M N O P R S T U V Y Z Q W X 0 1 2 3 4 5 6 7 8 9
Örnek : ( search,araba,daire,domain,spor,film,dizi,aile,cocuk,bebek,google.com,domain.org,telefon.net vb...)
16-05-2022 Bugün düşecek domainler

Sitene Domain Code Ekle Bölümü İncele

Rasgele Domain Arama Bölümü İncele

Domain Tags Bölümü İncele

Google Trends ( New ) Bölümü İncele

Boş Domain Listesi Bölümü İncele

Google de en çok arananlar Bölümü İncele

Bugün En son yapılan domain sorgulamaları Domainleri İncele

Backlink Domainler Domainleri İncele

Özel Domainler Domainleri İncele

Şehirlere Göre Domainler Domainleri İncele

Actual Search

Domain Blog
Meclistorbayasaicinmesaiyapacak
isvecteiktidarpartisindennatouyeligineyesilisik
Valerianismaelsonunakadarsavastik
Filedevakifbanksampiyonoldu
Kktcdekoalisyonhukumetikuruldu
G7TreffenimNordenKeineProtestezuBeginn
Topgunkellymcgillismegryan
Eyupspordahamzahamzaogludonemisonaerdi
Abdukraynaceligineuygulanantarifeleriaskiyaaldi
Kktccumhurbaskanitatarhukumetikurmagoreviniicisleribakaniusteleverdi
Abddetarimdisiistihdambeklentiyiasti
Eskspekulatiffiyathareketlerinitakipediyoruz
Millihaltercihakankurnazdanaltinmadalya
istanbulhavalimaniseyirterasibasvurularibasliyor
Hakankurnazdunyasampiyonuoldu
Anidenbastirankaryagisiyuksekovayibeyazaburudu
Putinsreputedgirlfriendalinakabaevaeusanctions
Alabamavickywhitecaseywhitesearchthursday
Samsunasehitatesidustu
Sivassporkafilesiistanbulda
Kayadandusenaskersehitoldu
Baskenttebayramoncesihelikopterletrafikdenetimi
Bilecikeskisehiryolundakiaracyanginiulasimiaksatti
Otoyollardabayramyogunlugubasladi
Teknofest2022uluslararasiserbestgorevihayarismasikutahyadayapilacak
Abdilerusyaarasindakitutuklutakasiturkiyedeyapildi
Uaeabaskanigrossizaporijyanukleersantralineerisimistedi
Cumhurbaskanierdoganturgevheyetinikabuletti
Abmacaristanasartlifonvermesurecinibaslatti
Uyusturucusaticilarinajandarmadannefeskesenoperasyon
Bakannebatikkmhiledovizdekioynakliklarulkegundemindencikti
Commerceantitrustbill
NeueIdeeKiezohneprivateParkplaetze
Entlastungspaket2022300EuroKinderbonuswasdasPaketbringt
Petedavidsonpeacockseriescomedy
Faucicovidpandemicphase
Yerlivemillirobotlartekirdagda
Capehellesanitindatoren
Slovenyadahalksandikbasinagitti
Karamurseldedenizyuzeyindekirlilikolustu
Sakaryadasampiyonluksevinci
Besiktastacanbozdogankasimpasamacindaoynayamayacak
Bursaspordenizlisporukonukediyor
Otokaratlas3dyisatisasundu
Altiilacdahageriodemelistesinealindi
Koyyoluheyelannedeniylecoktu
Bakanvarankileriteknolojifabrikasiacti
Putinyaptirimlarbasarisizoldu

Domain Blog

Libyadakiserarapetrolsahasindauretimdurdu
Borsagunurekorlarlatamamladi
Kayseridekazananyokpuanlarpaylasildi
Pentagonmoskovayiikiukraynafuzesivurdu
Trabzonspordaberaberlik
Tuketiciyeucuzsebzemujdesi
Yenitorbameclistekkmdesirketlereyenidenvergiistisnasi
Cumhurbaskanligikabinesitoplandi
Yenidogankeciyigorenlergozlerineinanamadi
Besiktasalanyasporudortgolledevirdi
Josefgolunutaraftarlakutladi
Ukraynaverusyaarasindaesirdegisimiyapildi
Trabzonsporgaziantepfkilegolsuzberaberekaldi
Medyakultursanatveturizmbulusmalarikonyadabasladi
Dehsetverenkazaninsebebiortayaciktiotomatikviteshakimiyetkaybettirmis
Cavusoglubucadangelengoruntulermuzakerelerigolgeledi
Chpdenkiraartislariicinonerge
Kinikosbdekiyatirimcilardogalgazbekliyor
istanbuldasaganakyagisuyarisi
Cuneytcakiraisvicreicinonaycikti
Alexjonessandyhookdefamationsuit
Canakkaledeormanyangini
Cumhurbaskanierdoganputinilegorustu
israilvebaeserbestticaretanlasmasimuzakerelerinitamamladi
Cernobildeotuzbirnoktadayangincikti
Geridonusumtesisindekorkutanyangin
Thyistanbulmoskovaucaginabombaihbari
Bodrumdasezonunilkdishatucusukarsilandi
Rizeveartvindeyogunkarbekleniyor
Katargazzedeelektronikprotezmerkeziacti
insankanindailkkezmikroplastiklererastlandi
Caldigiatlamarketegiripattankasadaindi
EweBasketsOldenburgmuessenaufCenterBreunigverzichten
Debrameadowsmarknorthcarolinavoterform
Yenisporyasasiteklifitbmmde
Turkiyedekoronavirusvakasayilaridususegecti
istanbuldakaryagisietkisinisurduruyor
Kopeklerdenkacarkenkamyonunaltindakalancocugunhayatitehlikesisuruyor
Devlettesvikleritanitimgunlerigazianteptebasladi
Evvemutfakesyalarisektorufastaalicilarlabulustu
Fenerbahcegalatasarayderbitarihibellioldu
Trabzondacokenistinatduvaripanigenedenoldu
Zelenskiyukraynalipolisleremadalyatakti
Silivridekarkeyfi
indianawalmartdistributioncenterfire
Donyoungdiesrepublicanalaskacongressman
HeimsiegSchalkebeschenktBueskenszumGeburtstag
Bulentkorkmazbircikisariyoruz
Erzincandaikinoktaucbuyuklugundedeprem
Natoputinukraynayihafifealdi
GirlsundBoysDayGeschlechtsuntypischeBerufeerkunden
Stocksfederalreserveinflationrussiaukraine

3 & 4 Karakter Satılık Domainler Domainleri İncele

3 Karakterli Boş Domainler Domainleri İncele

4 Karakterli Boş Domainler Domainleri İncele

Com Uzantılı Sadece Harf Bugün Düşecek Domainler Domainleri İncele

Net Uzantılı Sadece Harf Bugün Düşecek Domainler Domainleri İncele

Org Uzantılı Sadece Harf Bugün Düşecek Domainler Domainleri İncele

3 Karakter Bugün Düşecek Domainler Domainleri İncele

4 Karakter Bugün Düşecek Domainler Domainleri İncele

5 Karakter Bugün Düşecek Domainler Domainleri İncele

6 Karakter Bugün Düşecek Domainler Domainleri İncele

3 Karakter Domain Domainleri İncele

4 Karakter Domain Domainleri İncele

5 Karakter Domain Domainleri İncele

6 Karakter Domain Domainleri İncele

7 Karakter Domain Domainleri İncele

8 Karakter Domain Domainleri İncele

9 Karakter Domain Domainleri İncele

10 Karakter Domain Domainleri İncele

11 Karakter Domain Domainleri İncele

12 Karakter Domain Domainleri İncele

13 Karakter Domain Domainleri İncele

14 Karakter Domain Domainleri İncele

15 Karakter Domain Domainleri İncele

Com Uzantılı Bugün Düşecek Domainler Domainleri İncele

Net Uzantılı Bugün Düşecek Domainler Domainleri İncele

Org Uzantılı Bugün Düşecek Domainler Domainleri İncele

Tv Uzantılı Bugün Düşecek Domainler Domainleri İncele

Cc Uzantılı Bugün Düşecek Domainler Domainleri İncele

A ile başlayan bugün düşecek domain listesi Domainleri İncele

B ile başlayan bugün düşecek domain listesi Domainleri İncele

C ile başlayan bugün düşecek domain listesi Domainleri İncele

D ile başlayan bugün düşecek domain listesi Domainleri İncele

E ile başlayan bugün düşecek domain listesi Domainleri İncele

F ile başlayan bugün düşecek domain listesi Domainleri İncele

G ile başlayan bugün düşecek domain listesi Domainleri İncele

H ile başlayan bugün düşecek domain listesi Domainleri İncele

İ ile başlayan bugün düşecek domain listesi Domainleri İncele

J ile başlayan bugün düşecek domain listesi Domainleri İncele

K ile başlayan bugün düşecek domain listesi Domainleri İncele

L ile başlayan bugün düşecek domain listesi Domainleri İncele

M ile başlayan bugün düşecek domain listesi Domainleri İncele

N ile başlayan bugün düşecek domain listesi Domainleri İncele

O ile başlayan bugün düşecek domain listesi Domainleri İncele

P ile başlayan bugün düşecek domain listesi Domainleri İncele

R ile başlayan bugün düşecek domain listesi Domainleri İncele

S ile başlayan bugün düşecek domain listesi Domainleri İncele

T ile başlayan bugün düşecek domain listesi Domainleri İncele

U ile başlayan bugün düşecek domain listesi Domainleri İncele

V ile başlayan bugün düşecek domain listesi Domainleri İncele

Y ile başlayan bugün düşecek domain listesi Domainleri İncele

Z ile başlayan bugün düşecek domain listesi Domainleri İncele

Q ile başlayan bugün düşecek domain listesi Domainleri İncele

W ile başlayan bugün düşecek domain listesi Domainleri İncele

X ile başlayan bugün düşecek domain listesi Domainleri İncele

0 ile başlayan bugün düşecek domain listesi Domainleri İncele

1 ile başlayan bugün düşecek domain listesi Domainleri İncele

2 ile başlayan bugün düşecek domain listesi Domainleri İncele

3 ile başlayan bugün düşecek domain listesi Domainleri İncele

4 ile başlayan bugün düşecek domain listesi Domainleri İncele

5 ile başlayan bugün düşecek domain listesi Domainleri İncele

6 ile başlayan bugün düşecek domain listesi Domainleri İncele

7 ile başlayan bugün düşecek domain listesi Domainleri İncele

8 ile başlayan bugün düşecek domain listesi Domainleri İncele

9 ile başlayan bugün düşecek domain listesi Domainleri İncele

Domain, Sinema, Facebook, Google, Alexa, Arama, Search, Paypal, Özel, Boş, World, Book, Haber, Sohbet, isim, Soft, Bank, Arkadaş, Turizm, Sanal, Oyun, Dizi, Film, Türk, İzle, Yazı, Radyo, Panel, Wanted, Oto, Auto, Seo, Rank, İstanbul, Ankara, Rss, Day, Home, Okey, Whois, Buy, Sale, Twitter, Takip, Site, Program, Blog, Man, And, Woman, Ders, Video, Show, Otel

Bilgilendirme

Domainler ve sitemiz hakkında bilgilendirmeler

Merhaba Kullanıcımız,

Sitemizde günlük olarak güncel domainler listelenmektedir. Sayfamızda bulunan tüm domainler bugün içerisinde düşecektir.Sizlere sunmakta olduğumuz domainlerin bilgilerini görebildiğiniz gibi, Satın alabilir, Backorder yapabilir, whois bilgilerini görebilirsiniz.

Domainleri almadan önce mutlaka kontrol edin. Her domain uzantısının düşeceği zaman geldiğinde boşa düşer düşmez alabilirsiniz. Unutmayın ki, Sizden önce başkasıda alabilme yetkisine sahiptir.

Site içerisinde arama yapabilirsiniz, Arama yaptığınız kelimeye göre içerisinde (Aranan kelime) ye uygunbugün düşecek domainleri görmeniz mümkün olacaktır. Örneğin : "Domain" Kelimesi ile arama yapın, sonuçların sadece "Domain" Kelimesini içeren tüm düşecek domainlerin listelendiğini göreceksiniz.

Listelenen domainlerde Kaç karakter olduğu, düşeceği tarih, whois bilgilerini görebilmeniz için bir botun ve satın alabilmeniz için bir link bulunmaktadır. Domain hakkında işlem yapabilirsiniz veya sadece görebilirsiniz.

Search.com.tr olarak sizlere com, net, org, tv ve cc uzantılı domainlere yer vermekteyiz. Kategorilerden herhangi birtanesini seçebilirsiniz. com, net ve org uzantılı domainlere özel, (Bu domainler genel tercihler arasındadır) Sadece harf olarak kategorilerimizde yer verdik.

Ayrıca sitemizde ilk harflerine göre domainleri bulmanız mümkün olacaktır. 0-9 Arasındaki rakamlar ile başlayan domainleri, A-Z ye Domainleri ve ingilizce karakter olarak w,x,q ile başlayan domain listesinide görebilirsiniz. Sizin için sitemizde yer alan özel domainler ve Şehirlere göre domainler sayfalarında ayrıca yer verdik.
Umarız ki aradığınız domainleri bizim sitemizden bulur ve kullanmaya başlarsınız.

Yukarda belirtilenler haricinde, Sorun, Şikayet, Öneri ve İstekleriniz için, destek@search.com.tr Adresi ile iletişime geçebilirsiniz.

Search.com.tr

Kullanım Şartları | Site Kodu | Kullanıcı Giriş | Arama | S.S.S | Özel Domainler | Site Haritası | RSS
2014 © search.com.tr | Tüm Hakları Gizlidir.
Telefon : +90 224 573 80 80
Gsm: +90 542 502 02 22
Destek : destek@search.com.tr

Valid XHTML 1.0 Strict Alexa Rank Google